30-MINUTE MEALS! Get the email series now
Royal Recipe

Cheesy Broccoli

5 from 1 vote
1 Comments
 Emma Harrison
By: Emma HarrisonUpdated: Mar 29, 2026
This post may contain affiliate links. Please read our disclosure policy.

A kid-friendly, classic side of bright steamed broccoli coated in a silky homemade cheese sauce. Ready in 25 minutes and perfect for weeknights or holiday plates.

Cheesy Broccoli

This cheesy broccoli is one of those simple dishes that feels like a warm hug on the plate. I first made it on a rushed weeknight when my kids were insisting on something cheesy and green at the same time. The bright green broccoli and the smooth, slightly tangy cheese sauce came together so well that it instantly joined my short list of guaranteed crowd-pleasers. It manages to be familiar and comforting while still tasting fresh, with tender-crisp florets and a sauce that clings without becoming gluey.

What makes this version special is the balance between technique and approachability. The broccoli is steam-simmered just long enough to retain a pleasant bite and vivid color. The cheese sauce starts with a classic butter and flour base that is slowly coaxed into a glossy, lump-free sauce with milk and careful whisking. A little Parmesan adds sharpness, while a pinch of ground mustard wakes up the cheddar. Because the sauce is made on the stovetop and the broccoli cooks quickly, you can have this on the table in under 30 minutes, which is why I turn to it for busy evenings and casual gatherings alike.

Why You'll Love This Recipe

  • Ready in about 25 minutes from start to finish, making it ideal for weeknights when you need a vegetable that feels special without extra fuss.
  • Uses pantry staples and basic dairy items so you can assemble it without a special shopping trip, perfect when you have cheddar and Parmesan on hand.
  • Kid-friendly flavor and texture, with broccoli still tender enough for picky eaters and cheese sauce that is smooth and not greasy.
  • Flexible service options: pour the sauce over the florets or toss them together so every bite is coated; both methods work well for leftovers.
  • Make-ahead friendly. The florets or the sauce can be refrigerated separately and reheated gently for easy meal prep or holiday side planning.
  • Customizable heat and seasoning. A pinch of cayenne or a little ground mustard lifts the flavor without overpowering the dish.

In my family the reaction was instant approval the first time I served this. My husband complimented the sauce texture and my daughter asked if she could have it again the next night. Over time I have tweaked the salt and cheese ratio, learning that adding the cheddar slowly prevents clumping and gives the sauce that silky finish everyone notices but can rarely describe.

Ingredients

  • Broccoli: 1 pound broccoli, cut into florets, about 6 cups. Look for firm stalks and deep green crowns. Fresh is best, but frozen florets will work; thaw and drain well.
  • Butter: 2 tablespoons unsalted butter. Salted can be used if you reduce the added salt later; butter is the flavor base for the sauce and gives richness.
  • Flour: 2 tablespoons all purpose flour. This creates a roux that thickens the milk into a glossy sauce; measure by spooning into the tablespoon.
  • Milk: 1 cup milk, I used 1 percent for a lighter finish but whole milk makes it creamier. Warmed slightly if you have a moment will speed thickening and reduce lumps.
  • Cheddar cheese: 2/3 cup shredded cheddar. Sharp or medium works; shred from a block for best melting and flavor. Pre-shredded cheese contains anti caking agents that can affect smoothness.
  • Parmesan: 2 tablespoons grated Parmesan cheese. Adds an umami lift and helps the sauce taste more complex.
  • Seasoning: 1/4 teaspoon kosher salt plus more to taste, pinch ground mustard optional, pinch cayenne optional. Small additions change depth dramatically.
  • Water: About 1 cup for simmering the broccoli. The broccoli will not be submerged; the water creates steam and a thin layer for gentle cooking.

Instructions

Steam the Broccoli: Place the florets in a large saucepan and add enough water to create a thin layer across the bottom, roughly 1 cup. Bring to a simmer over high heat, cover, and steam until the broccoli is bright green and crisp tender, 4 to 5 minutes. Drain and keep covered in a bowl to stay warm. Visual cue: the stems should be tender when pierced but still offer a slight resistance. Dry the Pan and Start the Roux: Carefully wipe the same pan dry with a towel. Return to medium low heat and melt the butter. Sprinkle the flour over the melted butter and whisk constantly until the mixture turns a faint golden color, about 1 minute. This cooks out the raw flour taste while keeping the roux light in color. Add the Milk and Thicken: Slowly pour the milk into the roux while whisking continuously to prevent lumps. Increase to a gentle simmer and whisk until the sauce thickens and coats the back of a spoon, about 3 minutes. Keep the heat controlled; too high and the sauce can scorch. Incorporate the Cheese: Reduce the heat to low. Add the shredded cheddar a small handful at a time, whisking until each addition melts before adding more. This prevents the cheese from seizing into grainy clumps. Stir in the Parmesan, salt, and the optional pinches of ground mustard and cayenne. Taste and adjust seasoning as needed. Serve Warm: You can either spoon the sauce over the broccoli or gently fold the florets into the sauce so everything is evenly coated. Serve immediately while the sauce is silky and fluid. If the sauce thickens too much, whisk in a tablespoon of warm milk to loosen it. Broccoli florets steaming in a pan, bright green and tender

You Must Know

  • Nutrition snapshot: about 215 calories per serving, 14 grams fat, 11 grams protein, 14 grams carbohydrates. This makes a satisfying but light accompaniment to mains.
  • Storage: refrigerate in an airtight container for up to 4 days. For best texture, store the florets and the sauce separately if possible.
  • Reheating: warm leftovers gently in a skillet over medium heat or in the microwave. Add a splash of milk if the sauce has thickened after chilling.
  • Freezing: you can freeze for up to 3 months; thaw overnight in the refrigerator before reheating. Note that texture will change slightly after freezing.

My favorite part of this preparation is how forgiving it is. Even when I make it for a crowd and the sauce thickens a bit as it sits on the warming tray, a little gentle heat and a splash of milk brings it right back. Guests often ask for the recipe because the sauce has that nostalgic comfort quality without being heavy.

Storage Tips

To keep the dish at peak quality, store the broccoli and the cheese sauce separately whenever possible. Place the florets in a shallow airtight container so they cool quickly, and store the sauce in a separate leakproof jar. Refrigerate both items for up to 4 days. When reheating on the stovetop, warm the sauce over low heat stirring regularly and add a tablespoon of milk if it looks too thick. For freezing, spoon the cooled sauce into a freezer bag and flatten it for quick thawing; the florets can be frozen but will be softer once thawed.

Ingredient Substitutions

If you are out of cheddar, try gruyere or a mild white cheddar for a slightly nutty flavor. For a sharper profile, use extra sharp cheddar and reduce salt by a pinch. For a dairy free version, use a vegan butter and plant based milk, and swap in a vegan melting cheese; texture will vary and may be less silky. To make the sauce gluten free, replace the all purpose flour with a 1 to 1 gluten free baking blend or use cornstarch as a thickener at half the quantity, mixed with cold milk before adding.

Serving Suggestions

This pairs beautifully with roasted chicken, grilled steak, meatloaf, or a simple roasted fish fillet. For a vegetarian plate, serve alongside a baked grain such as quinoa pilaf or lemon rice. Garnish with a sprinkle of extra Parmesan, a squeeze of lemon juice for brightness, or crisped breadcrumbs for texture. For holidays, arrange on a platter with toasted almond slivers and a scattering of chopped parsley for color.

Finished cheesy broccoli served in a white bowl, topped with grated Parmesan

Cultural Background

The combination of steamed or boiled green vegetables with a creamy cheese sauce has roots in classic American and British home cooking where simple staples were turned into comforting side dishes. Variations appear across many cuisines where dairy is used to enrich vegetables. Over decades, the pairing of broccoli and cheddar in particular became popular because the sharpness of cheddar complements the broccoli's mild green flavor, and the method is straightforward enough for home cooks of all skill levels.

Meal Prep Tips

For efficient weekly meal prep, steam a large batch of broccoli and store it in shallow containers for up to four days. Prepare the cheese sauce and cool it completely before refrigerating in a separate jar. When ready to serve, reheat the sauce gently and add the florets, or plate and microwave portions individually. This approach keeps texture better than reheating everything together from cold and saves you time on busy nights.

Final Notes

Whether you are plating this on a weeknight or tucking it onto a holiday table, this dish is a dependable way to make broccoli feel festive. The technique of making a roux based sauce and slowly melting the cheese is a small step that yields big rewards. Give yourself permission to tweak the seasoning and try different cheeses until you find the flavor that becomes your family favorite.

Enjoy sharing this simple, satisfying dish. It has earned a permanent spot in my rotation because it is quick, adaptable, and repeatedly wins compliments even from those who claim not to like vegetables.

Pro Tips

  • Add the shredded cheddar a small amount at a time over low heat to prevent the sauce from becoming grainy.

  • Store the florets and sauce separately to preserve texture during refrigeration.

  • If the sauce thickens after cooling, whisk in warm milk by the tablespoon until you reach the desired consistency.

  • Use block cheese and grate it yourself for the smoothest melting and best flavor.

This nourishing cheesy broccoli recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

Tags

Main Dishesrecipeside dishbroccolicheese sauceeasy weeknightkid-friendlyvegetarian
No ratings yet

Cheesy Broccoli

This Cheesy Broccoli recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 4 steaks
Cheesy Broccoli
Prep:10 minutes
Cook:15 minutes
Rest Time:10 mins
Total:25 minutes

Ingredients

Vegetables

Cheese Sauce

Instructions

1

Steam the broccoli

Place broccoli florets in a large saucepan and add about 1 cup water to create a thin layer across the pan bottom. Bring to a simmer over high heat, cover, and cook until bright green and crisp tender, 4 to 5 minutes. Drain and keep warm covered in a bowl.

2

Make the roux

Wipe the pan dry, return to medium low heat, and melt 2 tablespoons butter. Sprinkle 2 tablespoons flour over the butter and whisk constantly for about 1 minute until the flour turns just golden to cook out the raw flavor.

3

Add milk and thicken

Slowly pour in 1 cup milk while whisking continuously to avoid lumps. Let the sauce simmer gently until it thickens and coats the back of a spoon, about 3 minutes.

4

Melt in the cheeses

Reduce heat to low and add shredded cheddar a small handful at a time, whisking until each addition melts fully. Stir in 2 tablespoons grated Parmesan, 1/4 teaspoon kosher salt, and optional pinches of ground mustard and cayenne. Taste and adjust seasoning.

5

Combine and serve

Either spoon the cheese sauce over the drained broccoli or gently toss the florets into the sauce so everything is evenly coated. Serve immediately while warm and silky.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 215kcal | Carbohydrates: 14g | Protein:
11g | Fat: 14g | Saturated Fat: 4g |
Polyunsaturated Fat: 3g | Monounsaturated Fat:
6g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@kitchenfunwithmy3sons on social media!

Cheesy Broccoli

Categories:

Cheesy Broccoli

Did You Make This?

Leave a comment & rating below or tag @kitchenfunwithmysons on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family Photo

Hi, I'm !

Chef and recipe creator specializing in delicious Main Dishes cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

Get My 30-Minute Meals email series!

Quick and easy dinner ideas delivered to your inbox.